Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00124583-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00124583-M01, RRID:AB_464223
- Product name
- CANT1 monoclonal antibody (M01), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CANT1.
- Antigen sequence
ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVG
AVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVA
SYIMAFTLDGRFLLPETKIGSVKYEGIEFI- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ERG rearrangement in small cell prostatic and lung cancer.
Scheble VJ, Braun M, Wilbertz T, Stiedl AC, Petersen K, Schilling D, Reischl M, Seitz G, Fend F, Kristiansen G, Perner S
Histopathology 2010 Jun;56(7):937-43
Histopathology 2010 Jun;56(7):937-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CANT1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of CANT1 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CANT1 expression in transfected 293T cell line by CANT1 monoclonal antibody (M01), clone 2D3.Lane 1: CANT1 transfected lysate(44.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CANT1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
