HPA019627

CANT1 antibody from MilliporeSigma / Merck KGaA
SCAN-1, SHAPY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019627
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019627, RRID:AB_1845969
Product name
Anti-CANT1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019627
Antibody type
Polyclonal
Antigen
Soluble calcium-activated nucleotidase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNT
DDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPET
KIGSVK
Storage
-20C
Provider Type Product Number
- No reagents -