HPA019639

CANT1 antibody from Sigma-Aldrich
SCAN-1, SHAPY
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019639
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019639, RRID:AB_1845970
Product name
Anti-CANT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019639
Antibody type
Polyclonal
Antigen
Soluble calcium-activated nucleotidase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVL
ESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQ
IEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
Storage
-20C
Provider Type Product Number
- No reagents -