H00114897-B01

C1QTNF1 antibody from Abnova Corporation
CTRP1, FLJ90694, GIP, ZSIG37

Antibody data

Product number
H00114897-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114897-B01, RRID:AB_1113214
Product name
C1QTNF1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00114897-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C1QTNF1 protein.
Antigen sequence
MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQ
EWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPA
SRCLRCCDPGTSMYPATAVPQINITILKGEKGDRG
DRGLQGKYGKTGSAGARGHTGPKGQKGSMGAPGER
CKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLY
DHFNMFTGKFYCYVPGLYFFSLNVHTWNQKETYLH
IMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQ
VWVRLYKGERENAIFSEELDTYITFSGYLVKHATE
P
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -