Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503111 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGS
AGARG HTGPKGQKGS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel adipokine CTRP1 stimulates aldosterone production.
Jeon JH, Kim KY, Kim JH, Baek A, Cho H, Lee YH, Kim JW, Kim D, Han SH, Lim JS, Kim KI, Yoon do Y, Kim SH, Oh GT, Kim E, Yang Y
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 May;22(5):1502-11
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2008 May;22(5):1502-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting