HPA022151

PDE1A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022151
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022151, RRID:AB_1855118
Product name
Anti-PDE1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022151
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDR
AKTMSLILHAADISHPAKSWKLHYRWTMALMEEFF
LQGDKEAE
Storage
-20C
Provider Type Product Number
- No reagents -