HPA024603

ENPP7 antibody from Sigma-Aldrich
alk-SMase, NPP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024603, RRID:AB_1848174
Product name
Anti-ENPP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024603
Antibody type
Polyclonal
Antigen
Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEVEPFESVHVYELMCRLLGIVPEANDGHLATLLP
MLHTESALPPDGRPTLLPKGRSALPPSSRPLLVMG
LLGTVILLSE
Storage
-20C
Provider Type Product Number
- No reagents -