HPA023967

PDE7B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023967, RRID:AB_1855128
Product name
Anti-PDE7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023967
Antibody type
Polyclonal
Antigen
cAMP-specific 3',5'-cyclic phosphodiesterase 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCE
EFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFM
SYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQW
KSLLPRQHRSRGSS
Storage
-20C
Provider Type Product Number
- No reagents -