HPA024482

TBC1D16 antibody from Atlas Antibodies
FLJ20748, MGC25062
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024482
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024482, RRID:AB_1857790
Product name
Anti-TBC1D16
Provider product page
Atlas Antibodies - HPA024482
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSSPFCLSPISAALAESRGSVFLESDSSPPSSSDA
GLRFPDSNGLLQTPRWDEPQRVCALEQICGVFRVD
LGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHF
HHGGLDKLSDVFQQWKYCTEMQLKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -