HPA024482

TBC1D16 antibody from Sigma-Aldrich
FLJ20748, MGC25062
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024482
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024482, RRID:AB_1857790
Product name
Anti-TBC1D16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024482
Antibody type
Polyclonal
Antigen
TBC1 domain family member 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSSPFCLSPISAALAESRGSVFLESDSSPPSSSDA
GLRFPDSNGLLQTPRWDEPQRVCALEQICGVFRVD
LGHMRSLRLFFSDEACTSGQLVVASRESQYKVFHF
HHGGLDKLSDVFQQWKYCTEMQLKD
Storage
-20C
Provider Type Product Number
- No reagents -