HPA021878

EIF4A3 antibody from Atlas Antibodies
DDX48, EIF4AIII, Fal1, KIAA0111

Antibody data

Product number
HPA021878
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021878, RRID:AB_1848090
Product name
Anti-EIF4A3
Provider product page
Atlas Antibodies - HPA021878
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVD
VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK
QIIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.