HPA021878

EIF4A3 antibody from Sigma-Aldrich
DDX48, EIF4AIII, KIAA0111
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021878, RRID:AB_1848090
Product name
Anti-EIF4A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021878
Antibody type
Polyclonal
Antigen
Eukaryotic initiation factor 4A-III recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVD
VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK
QIIK
Storage
-20C
Provider Type Product Number
- No reagents -