Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023388 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CARD14
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCE
LQKERDQAYSARDSAQREISQSLVEKDSLRRQVFE
LTDQ- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The paracaspase MALT1 mediates CARD14‐induced signaling in keratinocytes
Afonina I, Van Nuffel E, Baudelet G, Driege Y, Kreike M, Staal J, Beyaert R
EMBO reports 2016;17(6):914-927
EMBO reports 2016;17(6):914-927
No comments: Submit comment
No validations: Submit validation data