HPA022533

CARD14 antibody from Sigma-Aldrich
BIMP2, CARMA2, PSORS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022533
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022533, RRID:AB_1846019
Product name
Anti-CARD14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022533
Antibody type
Polyclonal
Antigen
Caspase recruitment domain-containing protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNSYTMKDTAAHGTIPNYSRAQQQLIALIQDMTQQ
CTVTRKPSSGGPQKLVRIVSMDKAKASPLRLSFDR
GQLDPSRM
Storage
-20C
Provider Type Product Number
- No reagents -