HPA023436

SGSH antibody from Sigma-Aldrich
HSS, MPS3A, SFMD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023436, RRID:AB_1856806
Product name
Anti-SGSH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023436
Antibody type
Polyclonal
Antigen
N-sulphoglucosamine sulphohydrolase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPN
TPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVL
NDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL
Storage
-20C
Provider Type Product Number
- No reagents -