HPA024642

RPF1 antibody from Sigma-Aldrich
BXDC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024642, RRID:AB_1856428
Product name
Anti-BXDC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024642
Antibody type
Polyclonal
Antigen
Ribosome production factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKA
AAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLA
AKKKLKKEREALGDKAPPKPVPKTID
Storage
-20C
Provider Type Product Number
- No reagents -