AV52531

DUSP19 antibody from Sigma-Aldrich
DUSP17, SKRP1
No application information provided.

Antibody data

Product number
AV52531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV52531, RRID:AB_1847891
Product name
Anti-DUSP19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV52531
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human DUSP19 with an internal ID of P30444
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQE
GKESNKCDRIQENSS
Storage
-20C
Provider Type Product Number
- No reagents -