HPA021501

DUSP19 antibody from Sigma-Aldrich
DUSP17, SKRP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021501
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021501, RRID:AB_1847892
Product name
Anti-DUSP19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021501
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARI
HVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLL
GSQDAAHDLDTL
Storage
-20C
Provider Type Product Number
- No reagents -