HPA007033

antibody from Atlas Antibodies

Targeting: ADAP1 CENTA1, GCS1L

Antibody data

Submit

Validation data

Product number: HPA007033 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007033, RRID:AB_1846529
Product name: Anti-ADAP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVF IGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRK FLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ADAP1 protein structure - HPA007033 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ADAP1 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, hippocampus, ovary and tonsil using Anti-ADAP1 antibody HPA007033 (A) shows similar protein distribution across tissues to independent antibody HPA012049 (B).
Antibody #2 product nr: HPA012049
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human hippocampus using Anti-ADAP1 antibody HPA007033.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human ovary using Anti-ADAP1 antibody HPA007033.
Sample type: HUMAN