HPA007033

ADAP1 antibody from Sigma-Aldrich
CENTA1, GCS1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007033, RRID:AB_1846529
Product name
Anti-ADAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007033
Antibody type
Polyclonal
Antigen
Arf-GAP with dual PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVF
IGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRK
FLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Storage
-20C
Provider Type Product Number
- No reagents -