HPA018401

NUP35 antibody from Sigma-Aldrich
MP44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018401
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018401, RRID:AB_1854719
Product name
Anti-NUP35 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018401
Antibody type
Polyclonal
Antigen
Nucleoporin NUP53 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSN
TGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVK
PCID
Storage
-20C
Provider Type Product Number
- No reagents -