Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027306 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027306, RRID:AB_1857515
- Product name
- Anti-SSX2IP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DEMYKILLNDYEYRQKQILMENAELKKVLQQMKKE
MISLLSPQKKKPRERVDDSTGTVISDVEEDAGELS
RESMWDLSCETVREQLTNSIRKQWRILKSHVEKLD
NQVSKVHLEGFNDEDVISRQDHEQETE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references p38- and MK2-dependent signalling promotes stress-induced centriolar satellite remodelling via 14-3-3-dependent sequestration of CEP131/AZI1.
Centriolar satellite- and hMsd1/SSX2IP-dependent microtubule anchoring is critical for centriole assembly.
The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Tollenaere MAX, Villumsen BH, Blasius M, Nielsen JC, Wagner SA, Bartek J, Beli P, Mailand N, Bekker-Jensen S
Nature communications 2015 Nov 30;6:10075
Nature communications 2015 Nov 30;6:10075
Centriolar satellite- and hMsd1/SSX2IP-dependent microtubule anchoring is critical for centriole assembly.
Hori A, Peddie CJ, Collinson LM, Toda T
Molecular biology of the cell 2015 Jun 1;26(11):2005-19
Molecular biology of the cell 2015 Jun 1;26(11):2005-19
The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
Hori A, Morand A, Ikebe C, Frith D, Snijders AP, Toda T
Biochemical and biophysical research communications 2015 Dec 4-11;468(1-2):39-45
Biochemical and biophysical research communications 2015 Dec 4-11;468(1-2):39-45
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN