HPA027306

SSX2IP antibody from Sigma-Aldrich
hMsd1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027306
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027306, RRID:AB_1857515
Product name
Anti-SSX2IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027306
Antibody type
Polyclonal
Antigen
Afadin- and alpha-actinin-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEMYKILLNDYEYRQKQILMENAELKKVLQQMKKE
MISLLSPQKKKPRERVDDSTGTVISDVEEDAGELS
RESMWDLSCETVREQLTNSIRKQWRILKSHVEKLD
NQVSKVHLEGFNDEDVISRQDHEQETE
Storage
-20C
Provider Type Product Number
- No reagents -