HPA016959

KRT23 antibody from Sigma-Aldrich
CK23, DKFZP434G032, HAIK1, K23, MGC26158
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016959, RRID:AB_1852228
Product name
Anti-KRT23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016959
Antibody type
Polyclonal
Antigen
Keratin, type I cytoskeletal 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KHHVPSDFNVNVKVDTGPREDLIKVLEDMRQEYEL
IIKKKHRDLDTWYKEQSAAMSQEAASPATVQSRQG
DIHELKRTFQALEIDLQAQYSTKSALENMLSETQS
RYSCKLQDMQEIISHYEEELTQLR
Storage
-20C
Provider Type Product Number
- No reagents -