HPA019114

MCOLN2 antibody from Sigma-Aldrich
FLJ36691, TRP-ML2, TRPML2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019114, RRID:AB_1853645
Product name
Anti-MCOLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019114
Antibody type
Polyclonal
Antigen
Mucolipin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGT
MFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKN
SSFFRLEFYR
Storage
-20C
Provider Type Product Number
- No reagents -