HPA018303

OLIG3 antibody from Sigma-Aldrich
Bhlhb7, bHLHe20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018303
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018303, RRID:AB_1854796
Product name
Anti-OLIG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018303
Antibody type
Polyclonal
Antigen
Oligodendrocyte transcription factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESR
LNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYK
IKKQLSEQDLQQLRLKINGR
Storage
-20C
Provider Type Product Number
- No reagents -