Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018303 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018303, RRID:AB_1854796
- Product name
- Anti-OLIG3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESR
LNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYK
IKKQLSEQDLQQLRLKINGR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Generation of dorsoventral human spinal cord organoids via functionalizing composite scaffold for drug testing
Integration of Signals along Orthogonal Axes of the Vertebrate Neural Tube Controls Progenitor Competence and Increases Cell Diversity
Xue W, Li B, Liu H, Xiao Y, Li B, Ren L, Li H, Shao Z
iScience 2023;26(1):105898
iScience 2023;26(1):105898
Integration of Signals along Orthogonal Axes of the Vertebrate Neural Tube Controls Progenitor Competence and Increases Cell Diversity
Storey K, Sasai N, Kutejova E, Briscoe J
PLoS Biology 2014;12(7):e1001907
PLoS Biology 2014;12(7):e1001907
No comments: Submit comment
No validations: Submit validation data