HPA018303

OLIG3 antibody from Atlas Antibodies
Bhlhb7, bHLHe20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018303
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018303, RRID:AB_1854796
Product name
Anti-OLIG3
Provider product page
Atlas Antibodies - HPA018303
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESR
LNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYK
IKKQLSEQDLQQLRLKINGR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -