HPA022269

PERP antibody from Atlas Antibodies
dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022269
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022269, RRID:AB_1855219
Product name
Anti-PERP
Provider product page
Atlas Antibodies - HPA022269
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME
YAW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -