HPA020587

GULP1 antibody from Sigma-Aldrich
CED-6, CED6, GULP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020587
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020587, RRID:AB_1850452
Product name
Anti-GULP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020587
Antibody type
Polyclonal
Antigen
PTB domain-containing engulfment adapter protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITL
TIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQ
DLETENMELKNKVQDLENQLRITQVSA
Storage
-20C
Provider Type Product Number
- No reagents -