PAB20409

RNF43 antibody from Abnova Corporation
DKFZp781H0392, FLJ20315, URCC

Antibody data

Product number
PAB20409
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20409, RRID:AB_10966395
Product name
RNF43 polyclonal antibody
Provider product page
Abnova Corporation - PAB20409
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RNF43.
Antigen sequence
CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSY
QEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVA
RPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQ
QRLAGAQHPYAQGWGLSHLQSTSQH
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -