ABIN405533

RNF43 antibody from antibodies-online
DKFZp781H0392, FLJ20315, URCC

Antibody data

Product number
ABIN405533
Provider
antibodies-online
Product name
anti-Ring Finger Protein 43 (RNF43) antibody
Provider product page
antibodies-online - ABIN405533
Antibody type
Polyclonal
Antigen
The immunogen for anti-RNF43 antibody: synthetic peptide directed towards the middle region of human RNF43
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVP
TGETQ VSSHVHYHRH
Vial size
50 µg
Provider Type Product Number
- No reagents -