HPA008079

RNF43 antibody from Atlas Antibodies
DKFZp781H0392, FLJ20315, URCC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008079
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008079, RRID:AB_1856371
Product name
Anti-RNF43
Provider product page
Atlas Antibodies - HPA008079
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSY
QEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVA
RPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQ
QRLAGAQHPYAQGWGLSHLQSTSQH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -