HPA008079

RNF43 antibody from Sigma-Aldrich
DKFZp781H0392, FLJ20315, URCC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008079, RRID:AB_1856371
Product name
Anti-RNF43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008079
Antibody type
Polyclonal
Antigen
RING finger protein 43 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSY
QEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVA
RPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQ
QRLAGAQHPYAQGWGLSHLQSTSQH
Storage
-20C
Provider Type Product Number
- No reagents -