SAB2102033

RNF43 antibody from Sigma-Aldrich
DKFZp781H0392, FLJ20315, URCC
No application information provided.

Antibody data

Product number
SAB2102033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102033, RRID:AB_10605175
Product name
Anti-RNF43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102033
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_060233.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVP
TGETQVSSHVHYHRH
Storage
-20C
Provider Type Product Number
- No reagents -