Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029853 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029853, RRID:AB_10611822
- Product name
- Anti-CYR61
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASS
TALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKH
QCTCIDGAV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Inhibition of Increased Invasiveness of Breast Cancer Cells With Acquired Tamoxifen Resistance by Suppression of CYR61
Trehangelins ameliorate inflammation-induced skin senescence by suppressing the epidermal YAP-CCN1 axis
Deprogramming metabolism in pancreatic cancer with a bi-functional GPR55 inhibitor and biased β2 adrenergic agonist
Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions*
Regulation of Androgen Receptor Expression Alters AMPK Phosphorylation in the Endometrium: In Vivo and In Vitro Studies in Women with Polycystic Ovary Syndrome
BAUERSCHMITZ G, HÜCHEL S, GALLWAS J, GRÜNDKER C
Cancer Genomics - Proteomics 2023;20(6):531-538
Cancer Genomics - Proteomics 2023;20(6):531-538
Trehangelins ameliorate inflammation-induced skin senescence by suppressing the epidermal YAP-CCN1 axis
Yokota M, Kamiya Y, Suzuki T, Ishikawa S, Takeda A, Kondo S, Tohgasaki T, Nakashima T, Takahashi Y, Ōmura S, Sakurai T
Scientific Reports 2022;12(1)
Scientific Reports 2022;12(1)
Deprogramming metabolism in pancreatic cancer with a bi-functional GPR55 inhibitor and biased β2 adrenergic agonist
Wnorowski A, Dudzik D, Bernier M, Wójcik J, Keijzers G, Diaz-Ruiz A, Mazur K, Zhang Y, Han H, Scheibye-Knudsen M, Jozwiak K, Barbas C, Wainer I
Scientific Reports 2022;12(1)
Scientific Reports 2022;12(1)
Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions*
Schlage P, Kockmann T, Sabino F, Kizhakkedathu J, auf dem Keller U
Molecular & Cellular Proteomics 2015;14(12):3234-3246
Molecular & Cellular Proteomics 2015;14(12):3234-3246
Regulation of Androgen Receptor Expression Alters AMPK Phosphorylation in the Endometrium: In Vivo and In Vitro Studies in Women with Polycystic Ovary Syndrome
Li X, Pishdari B, Cui P, Hu M, Yang H, Guo Y, Jiang H, Feng Y, Billig H, Shao R
International Journal of Biological Sciences 2015;11(12):1376-1389
International Journal of Biological Sciences 2015;11(12):1376-1389
No comments: Submit comment
No validations: Submit validation data