Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029853 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029853, RRID:AB_10611822
- Product name
- Anti-CYR61
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASS
TALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKH
QCTCIDGAV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Regulation of Androgen Receptor Expression Alters AMPK Phosphorylation in the Endometrium: In Vivo and In Vitro Studies in Women with Polycystic Ovary Syndrome.
Li X, Pishdari B, Cui P, Hu M, Yang HP, Guo YR, Jiang HY, Feng Y, Billig H, Shao R
International journal of biological sciences 2015;11(12):1376-89
International journal of biological sciences 2015;11(12):1376-89
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows cytolasmic positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
- Sample type
- HUMAN