HPA018132

ZNHIT6 antibody from Sigma-Aldrich
BCD1, C1orf181, FLJ20729, NY-BR-75
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018132, RRID:AB_1848789
Product name
Anti-ZNHIT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018132
Antibody type
Polyclonal
Antigen
Zinc finger HIT domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINH
PVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSL
PCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL
Storage
-20C
Provider Type Product Number
- No reagents -