HPA024019

CEP131 antibody from Atlas Antibodies
AZ1, AZI1, KIAA1118
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024019
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024019, RRID:AB_1845227
Product name
Anti-CEP131
Provider product page
Atlas Antibodies - HPA024019
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDD
QPRGFTLPSNARSSSALDSPAGPRRKECTVALAPN
FTANNRSNKGAVGNCVTTM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -