HPA024019

CEP131 antibody from Sigma-Aldrich
AZ1, AZI1, KIAA1118
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024019, RRID:AB_1845227
Product name
Anti-AZI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024019
Antibody type
Polyclonal
Antigen
5-azacytidine-induced protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDD
QPRGFTLPSNARSSSALDSPAGPRRKECTVALAPN
FTANNRSNKGAVGNCVTTM
Storage
-20C
Provider Type Product Number
- No reagents -