HPA003534

GNG2 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003534
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003534, RRID:AB_1079004
Product name
Anti-GNG2
Provider product page
Atlas Antibodies - HPA003534
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYC
EAHAKEDPLLTPVPASENPFREK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -