Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003534 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003534, RRID:AB_1079004
- Product name
- Anti-GNG2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYC
EAHAKEDPLLTPVPASENPFREK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The claustrum of the bottlenose dolphin Tursiops truncatus (Montagu 1821).
Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
Cozzi B, Roncon G, Granato A, Giurisato M, Castagna M, Peruffo A, Panin M, Ballarin C, Montelli S, Pirone A
Frontiers in systems neuroscience 2014;8:42
Frontiers in systems neuroscience 2014;8:42
Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum.
Pirone A, Cozzi B, Edelstein L, Peruffo A, Lenzi C, Quilici F, Antonini R, Castagna M
PloS one 2012;7(9):e44745
PloS one 2012;7(9):e44745
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and GNG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403285).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows distinct positivity in endothelial cells.
- Sample type
- HUMAN