HPA003534

GNG2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003534, RRID:AB_1079004
Product name
Anti-GNG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003534
Antibody type
Polyclonal
Antigen
Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYC
EAHAKEDPLLTPVPASENPFREK
Storage
-20C
Provider Type Product Number
- No reagents -