HPA024631

SLC38A10 antibody from Atlas Antibodies
MGC15523, PP1744
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024631
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024631, RRID:AB_1853860
Product name
Anti-SLC38A10
Provider product page
Atlas Antibodies - HPA024631
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVA
VAEDGREKPKLPKEREELEQAQIKGPVDVPGREDG
KEAPEEAQLDRPGQGIAVPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -