Antibody data
- Product number
- HPA024631
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024631, RRID:AB_1853860
- Product name
- Anti-SLC38A10
- Provider product page
- Atlas Antibodies - HPA024631
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVA
VAEDGREKPKLPKEREELEQAQIKGPVDVPGREDG
KEAPEEAQLDRPGQGIAVPV
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-SLC38A10 antibody HPA024631.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-SLC38A10 antibody HPA024631.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-SLC38A10 antibody. Corresponding SLC38A10 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder, kidney, skeletal muscle and testis using Anti-SLC38A10 antibody HPA024631 (A) shows similar protein distribution across tissues to independent antibody HPA023161 (B).
- Antibody #2 product nr
- HPA023161
- Antibody provider
- Atlas Antibodies
- Show more
Explore
Validate
Learn
Supportive data in Antibodypedia
Enhanced validation
