HPA024631

antibody from Atlas Antibodies

Targeting: SLC38A10 MGC15523, PP1744

Antibody data

Submit

Validation data

Product number: HPA024631 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA024631, RRID:AB_1853860
Product name: Anti-SLC38A10
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PEDLAGEAPGGRLGEAEGLMKVEAARLSAQDPVVA VAEDGREKPKLPKEREELEQAQIKGPVDVPGREDG KEAPEEAQLDRPGQGIAVPV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC38A10 protein structure - HPA024631 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-SLC38A10 antibody. Corresponding SLC38A10 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human gallbladder, kidney, skeletal muscle and testis using Anti-SLC38A10 antibody HPA024631 (A) shows similar protein distribution across tissues to independent antibody HPA023161 (B).
Antibody #2 product nr: HPA023161
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SLC38A10 antibody HPA024631.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SLC38A10 antibody HPA024631.
Sample type: HUMAN