HPA023161

SLC38A10 antibody from Sigma-Aldrich
MGC15523, PP1744
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023161, RRID:AB_2190402
Product name
Anti-SLC38A10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023161
Antibody type
Polyclonal
Antigen
Putative sodium-coupled neutral amino acid transporter 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPE
LRVISDGEQGGQQGHRLDHGGHLEMRKA
Storage
-20C
Provider Type Product Number
- No reagents -