HPA026665

NMBR antibody from Sigma-Aldrich
BB1, BB1R
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026665
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026665, RRID:AB_1854527
Product name
Anti-NMBR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026665
Antibody type
Polyclonal
Antigen
Neuromedin-B receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTS
LKSNAKNMVTNSVLLNGHSMKQEMAL
Storage
-20C
Provider Type Product Number
- No reagents -