SAB2101607

NMBR antibody from MilliporeSigma / Merck KGaA
BB1, BB1R
No application information provided.

Antibody data

Product number
SAB2101607
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101607, RRID:AB_10604232
Product name
Anti-NMBR antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101607
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_002502.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGT
TTELVIRCVIPSLYL
Storage
-20C
Provider Type Product Number
- No reagents -