H00025797-A01

antibody from Abnova Corporation

Targeting: QPCT GCT, QC

No application information provided.

Antibody Data

Product number

H00025797-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00025797-A01, RRID:AB_606897

Product name

QPCT polyclonal antibody (A01)

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a partial recombinant QPCT.

Antigen sequence

PNSARWFERLQAIEHELHELGLLKDHSLEGRYFQN
YSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHT
MDDNEENLDESTIDNLNKILQVFVLEYL


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

Glutaminyl cyclase in human cortex: correlation with (pGlu)-amyloid-β load and cognitive decline in Alzheimer's disease.

Morawski M, Schilling S, Kreuzberger M, Waniek A, Jäger C, Koch B, Cynis H, Kehlen A, Arendt T, Hartlage-Rübsamen M, Demuth HU, Roßner S
Journal of Alzheimer's disease : JAD 2014;39(2):385-400

---

Inhibition of glutaminyl cyclase attenuates cell migration modulated by monocyte chemoattractant proteins.

Chen YL, Huang KF, Kuo WC, Lo YC, Lee YM, Wang AH
The Biochemical journal 2012 Mar 1;442(2):403-12

---

Glutaminyl cyclase contributes to the formation of focal and diffuse pyroglutamate (pGlu)-Aβ deposits in hippocampus via distinct cellular mechanisms.

Hartlage-Rübsamen M, Morawski M, Waniek A, Jäger C, Zeitschel U, Koch B, Cynis H, Schilling S, Schliebs R, Demuth HU, Rossner S
Acta neuropathologica 2011 Jun;121(6):705-19

---

Distinct glutaminyl cyclase expression in Edinger-Westphal nucleus, locus coeruleus and nucleus basalis Meynert contributes to pGlu-Abeta pathology in Alzheimer's disease.

Morawski M, Hartlage-Rübsamen M, Jäger C, Waniek A, Schilling S, Schwab C, McGeer PL, Arendt T, Demuth HU, Rossner S
Acta neuropathologica 2010 Aug;120(2):195-207