HPA008406

QPCT antibody from Sigma-Aldrich
GCT, QC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008406
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008406, RRID:AB_1855981
Product name
Anti-QPCT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008406
Antibody type
Polyclonal
Antigen
Glutaminyl-peptide cyclotransferase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLI
FFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPG
ARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSAR
WFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGG
VIQDDH
Storage
-20C
Provider Type Product Number
- No reagents -