H00007045-B01P

TGFBI antibody from Abnova Corporation
BIGH3, CDB1, CDGG1, CSD1, CSD2, CSD3, LCD1

Antibody data

Product number
H00007045-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007045-B01P, RRID:AB_1581314
Product name
TGFBI purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00007045-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TGFBI protein.
Antigen sequence
MALFVRLLALALALALGPAATLAGPAKSPYQLVLQ
HSRLRGRQHGPNVCAVQKVIGTNRKYFTNCKQWYQ
RKICGKSTVISYECCPGYEKVPGEKGCPAALPLSN
LYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTI
FAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHM
VGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIV
TVNCARLLKADHHATNGVVHLIDKVISTITNNIQQ
IIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAP
TNEAFEKIPSETLNRILGDPEALRDLLNNHILKSA
MCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKA
IISNKDILATNGVIHYIDELLIPDSAKTLFELAAE
SDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVF
KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTL
ETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGT
LFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSA
GLTETLNREGVYTVFAPTNEAFRALPPRERSRLLG
DAKELANILKYHIGDEILVSGGIGALVRLKSLQGD
KLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITN
VLQPPANRPQERGDELADSALEIFKQASAFSRASQ
RSVRLAPVYQKLLERMKH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -