HPA008612

TGFBI antibody from Atlas Antibodies
BIGH3, CDB1, CDGG1, CSD1, CSD2, CSD3, LCD1

Antibody data

Product number
HPA008612
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008612, RRID:AB_1857970
Product name
Anti-TGFBI
Provider product page
Atlas Antibodies - HPA008612
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DHHATNGVVHLIDKVISTITNNIQQIIEIEDTFET
LRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPS
ETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGL
SVETLEGTTLEVGCSGDMLTINGKAIISNKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.