HPA008612

TGFBI antibody from Sigma-Aldrich
BIGH3, CDB1, CDGG1, CSD1, CSD2, CSD3, LCD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008612
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008612, RRID:AB_1857970
Product name
Anti-TGFBI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008612
Antibody type
Polyclonal
Antigen
Transforming growth factor-beta-induced protein ig-h3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHHATNGVVHLIDKVISTITNNIQQIIEIEDTFET
LRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPS
ETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGL
SVETLEGTTLEVGCSGDMLTINGKAIISNKD
Storage
-20C
Provider Type Product Number
- No reagents -