HPA027168

KYAT3 antibody from Atlas Antibodies
CCBL2, KAT3, KATIII, RBM1, RP11-82K18.3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027168
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027168, RRID:AB_1852078
Product name
Anti-KYAT3
Provider product page
Atlas Antibodies - HPA027168
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWM
TKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKD
STLDAAEEIIKAWSVQKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -